SCOP 1.69: Domain d2dlfh_: 2dlf H:

Lineage for d2dlfh_ (2dlf H:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (42 PDB entries)

8. Domain d2dlfh_: 2dlf H: [20385]
   Other proteins in same PDB: d2dlfl_
   part of anti-dansyl Fv

Details for d2dlfh_

PDB Entry: 2dlf, 1.55 Å

PDB Description: high resolution crystal structure of the fv fragment from an anti-dansyl switch variant antibody igg2a(s) crystallized at ph 6.75

SCOP Domain Sequences for d2dlfh_:

Sequence; same for both SEQRES and ATOM records:

>d2dlfh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1}
evkleesggglvqpggsmklscatsgftfsdawmdwvrqspekglewvaeirnkannhat
yyaesvkgrftisrddskrrvylqmntlraedtgiyyctgiyyhypwfaywgqgtlvtvs

Timeline for d2dlfh_:

• d2dlfh_ first appeared (with stable ids) in SCOP 1.55
  
• d2dlfh_ appears in SCOP 1.67
  
• d2dlfh_ appears in SCOP 1.71
  
• d2dlfh_ appears in the current release, SCOPe 2.08