SCOPe 2.04: Domain d2cw3b1: 2cw3 B:8-90

Lineage for d2cw3b1 (2cw3 B:8-90)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (26 species)
   not a true protein

7. Species Perkinsus marinus [TaxId:31276] [225086] (2 PDB entries)

8. Domain d2cw3b1: 2cw3 B:8-90 [203840]
   Other proteins in same PDB: d2cw3a2, d2cw3b2
   automated match to d1isca1
   complexed with fe

Details for d2cw3b1

PDB Entry: 2cw3, 2.5 Å

PDB Description: x-ray structure of pmsod2, superoxide dismutase from perkinsus marinus

PDB Compounds: (B:) iron superoxide dismutase

SCOPe Domain Sequences for d2cw3b1:

Sequence; same for both SEQRES and ATOM records:

>d2cw3b1 a.2.11.0 (B:8-90) automated matches {Perkinsus marinus [TaxId: 31276]}
lrmtlpyglealepvisaatvdfhynkhhqgyiqklldatglpesrinlkslvtlgpdra
genvfnaagqiynhnmywlsmvp

Timeline for d2cw3b1:

• d2cw3b1 first appeared in SCOPe 2.03
  
• d2cw3b1 appears in SCOPe 2.05
  
• d2cw3b1 appears in the current release, SCOPe 2.08