Lineage for d2dlfl_ (2dlf L:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102046Species Anti-dansyl Fv, (mouse), kappa L chain [48882] (2 PDB entries)
  8. 102050Domain d2dlfl_: 2dlf L: [20384]

Details for d2dlfl_

PDB Entry: 2dlf (more details), 1.55 Å

PDB Description: high resolution crystal structure of the fv fragment from an anti-dansyl switch variant antibody igg2a(s) crystallized at ph 6.75

SCOP Domain Sequences for d2dlfl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dlfl_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Anti-dansyl Fv, (mouse), kappa L chain}
dvvmtqtplslpvslgnqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtkleikr

SCOP Domain Coordinates for d2dlfl_:

Click to download the PDB-style file with coordinates for d2dlfl_.
(The format of our PDB-style files is described here.)

Timeline for d2dlfl_: