SCOPe 2.05: Domain d2cw2b2: 2cw2 B:90-201

Lineage for d2cw2b2 (2cw2 B:90-201)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (30 species)
   not a true protein

7. Species Perkinsus marinus [TaxId:31276] [225087] (2 PDB entries)

8. Domain d2cw2b2: 2cw2 B:90-201 [203837]
   Other proteins in same PDB: d2cw2a1, d2cw2b1
   automated match to d1unfx2
   complexed with fe

Details for d2cw2b2

PDB Entry: 2cw2, 1.86 Å

PDB Description: crystal structure of superoxide dismutase from p. marinus

PDB Compounds: (B:) superoxide dismutase 1

SCOPe Domain Sequences for d2cw2b2:

Sequence; same for both SEQRES and ATOM records:

>d2cw2b2 d.44.1.0 (B:90-201) automated matches {Perkinsus marinus [TaxId: 31276]}
ngggeptgkiaelitrdfgsfekfkedfsaaavghfgsgwvwliaddgklkivqghdagn
piresktplmnidvwehayyidyrnaraqyvknywnlvnwdfvndnvakagi

Timeline for d2cw2b2:

• d2cw2b2 first appeared in SCOPe 2.03
  
• d2cw2b2 appears in SCOPe 2.04
  
• d2cw2b2 appears in SCOPe 2.06
  
• d2cw2b2 appears in the current release, SCOPe 2.08