SCOP 1.65: Domain d1dlfh_: 1dlf H:

Lineage for d1dlfh_ (1dlf H:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (22 PDB entries)

8. Domain d1dlfh_: 1dlf H: [20383]
   Other proteins in same PDB: d1dlfl_
   part of anti-dansyl Fv
   complexed with so4

Details for d1dlfh_

PDB Entry: 1dlf, 1.45 Å

PDB Description: high resolution crystal structure of the fv fragment from an anti-dansyl switch variant antibody igg2a(s) crystallized at ph 5.25

SCOP Domain Sequences for d1dlfh_:

Sequence; same for both SEQRES and ATOM records:

>d1dlfh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1}
evkleesggglvqpggsmklscatsgftfsdawmdwvrqspekglewvaeirnkannhat
yyaesvkgrftisrddskrrvylqmntlraedtgiyyctgiyyhypwfaywgqgtlvtvs

Timeline for d1dlfh_:

• d1dlfh_ first appeared (with stable ids) in SCOP 1.55
  
• d1dlfh_ appears in SCOP 1.63
  
• d1dlfh_ appears in SCOP 1.67
  
• d1dlfh_ appears in the current release, SCOPe 2.08