SCOP 1.57: Domain d1dlfh_: 1dlf H:

Lineage for d1dlfh_ (1dlf H:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Anti-dansyl Fv, (mouse), kappa L chain [48882] (2 PDB entries)

8. Domain d1dlfh_: 1dlf H: [20383]

Details for d1dlfh_

PDB Entry: 1dlf, 1.45 Å

PDB Description: high resolution crystal structure of the fv fragment from an anti-dansyl switch variant antibody igg2a(s) crystallized at ph 5.25

SCOP Domain Sequences for d1dlfh_:

Sequence; same for both SEQRES and ATOM records:

>d1dlfh_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Anti-dansyl Fv, (mouse), kappa L chain}
evkleesggglvqpggsmklscatsgftfsdawmdwvrqspekglewvaeirnkannhat
yyaesvkgrftisrddskrrvylqmntlraedtgiyyctgiyyhypwfaywgqgtlvtvs

Timeline for d1dlfh_:

• d1dlfh_ first appeared (with stable ids) in SCOP 1.55
  
• d1dlfh_ appears in SCOP 1.59
  
• d1dlfh_ appears in the current release, SCOPe 2.08