Lineage for d1dlfl_ (1dlf L:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287738Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287841Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (98 PDB entries)
  8. 287843Domain d1dlfl_: 1dlf L: [20382]
    Other proteins in same PDB: d1dlfh_
    part of anti-dansyl Fv
    complexed with so4

Details for d1dlfl_

PDB Entry: 1dlf (more details), 1.45 Å

PDB Description: high resolution crystal structure of the fv fragment from an anti-dansyl switch variant antibody igg2a(s) crystallized at ph 5.25
PDB Compounds: (L:)

SCOP Domain Sequences for d1dlfl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlfl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
dvvmtqtplslpvslgnqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtkleikr

SCOP Domain Coordinates for d1dlfl_:

Click to download the PDB-style file with coordinates for d1dlfl_.
(The format of our PDB-style files is described here.)

Timeline for d1dlfl_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dlfh_