SCOPe 2.08: Domain d1c12b1: 1c12 B:306-413

Lineage for d1c12b1 (1c12 B:306-413)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (40 PDB entries)
   Uniprot P18532 # HV61_MOUSE Ig heavy chain V region 1B43 precursor

8. Domain d1c12b1: 1c12 B:306-413 [20381]
   Other proteins in same PDB: d1c12a1, d1c12a2, d1c12b2, d1c12b3
   part of antibody directed against the musk odorant traseolide
   complexed with trz

Details for d1c12b1

PDB Entry: 1c12, 2.6 Å

PDB Description: insight in odorant perception: the crystal structure and binding characteristics of antibody fragments directed against the musk odorant traseolide

PDB Compounds: (B:) protein (antibody fragment fab)

SCOPe Domain Sequences for d1c12b1:

Sequence; same for both SEQRES and ATOM records:

>d1c12b1 b.1.1.1 (B:306-413) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]}
esgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmgyisysgstsyspslk
srisltrdtsknqfflqlnsvttedtatyycvtsltwllrrkrsywgqgttvtvss

Timeline for d1c12b1:

• d1c12b1 first appeared (with stable ids) in SCOP 1.55
  
• d1c12b1 appears in SCOPe 2.07