Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins) contains Pfam PF00788 and Pfam PF02196 |
Protein Phoshoinositide 3-kinase (PI3K) [54274] (2 species) includes parts of the flanking linkers |
Species Human (Homo sapiens) [TaxId:9606] [54276] (77 PDB entries) |
Domain d2chxa1: 2chx A:144-322 [203791] Other proteins in same PDB: d2chxa2, d2chxa3, d2chxa4 automated match to d1e8ya3 complexed with 090 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2chx (more details), 2.5 Å
SCOPe Domain Sequences for d2chxa1:
Sequence, based on SEQRES records: (download)
>d2chxa1 d.15.1.5 (A:144-322) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]} seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdipe sqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
>d2chxa1 d.15.1.5 (A:144-322) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]} seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakdfvlrvcgr deylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
Timeline for d2chxa1: