SCOP 1.55: Domain d1cf8h1: 1cf8 H:1-113

Lineage for d1cf8h1 (1cf8 H:1-113)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Catalytic Fab 19A4 (mouse), kappa L chain [48880] (1 PDB entry)

8. Domain d1cf8h1: 1cf8 H:1-113 [20379]
   Other proteins in same PDB: d1cf8h2, d1cf8l2

Details for d1cf8h1

PDB Entry: 1cf8, 2.7 Å

PDB Description: Convergence of catalytic antibody and terpene cyclase mechanisms: polyene cyclization directed by carbocation-pi interactions

SCOP Domain Sequences for d1cf8h1:

Sequence; same for both SEQRES and ATOM records:

>d1cf8h1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Catalytic Fab 19A4 (mouse), kappa L chain}
dvqlqesgpglvkpsqslsltctvtgysitsgyawnwirqfpgnklewmgyirysgdtry
npslksrisitrdtsknqfflqlnsvttedtatyycaigygnsdywgqgtlvtvsa

Timeline for d1cf8h1:

• d1cf8h1 appears in SCOP 1.57
  
• d1cf8h1 appears in the current release, SCOPe 2.08