SCOPe 2.06: Domain d1cf8l1: 1cf8 L:1-107

Lineage for d1cf8l1 (1cf8 L:1-107)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88527] (13 PDB entries)

8. Domain d1cf8l1: 1cf8 L:1-107 [20378]
   Other proteins in same PDB: d1cf8h1, d1cf8h2, d1cf8l2
   part of catalytic Fab HA-19A4 with a polyene cyclase activity
   complexed with cd, haz

Details for d1cf8l1

PDB Entry: 1cf8, 2.7 Å

PDB Description: Convergence of catalytic antibody and terpene cyclase mechanisms: polyene cyclization directed by carbocation-pi interactions

PDB Compounds: (L:) protein (catalytic antibody 19a4 (light chain))

SCOPe Domain Sequences for d1cf8l1:

Sequence; same for both SEQRES and ATOM records:

>d1cf8l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
divltqsptimsvspgekvtltcsasssvssnyvywyqqkpgsspkvwiystsnlasgvp
arfsgsgsgtsysltissmeaedaasyfclqwssfpytfgggtklelk

Timeline for d1cf8l1:

• d1cf8l1 first appeared (with stable ids) in SCOP 1.55
  
• d1cf8l1 appears in SCOPe 2.05
  
• d1cf8l1 appears in SCOPe 2.07
  
• d1cf8l1 appears in the current release, SCOPe 2.08