Class a: All alpha proteins [46456] (284 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
Protein automated matches [226859] (26 species) not a true protein |
Species Deinococcus radiodurans [TaxId:243230] [225052] (2 PDB entries) |
Domain d2cdya1: 2cdy A:-2-87 [203770] Other proteins in same PDB: d2cdya2, d2cdyb2, d2cdyc2, d2cdyd2 automated match to d1y67a1 complexed with mn |
PDB Entry: 2cdy (more details), 2 Å
SCOPe Domain Sequences for d2cdya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cdya1 a.2.11.0 (A:-2-87) automated matches {Deinococcus radiodurans [TaxId: 243230]} alaytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqq ldrvpadkkgalrnnagghanhsmfwqim
Timeline for d2cdya1: