SCOPe 2.03: Domain d3fctd1: 3fct D:1-114

Lineage for d3fctd1 (3fct D:1-114)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (177 PDB entries)
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor

8. Domain d3fctd1: 3fct D:1-114 [20377]
   Other proteins in same PDB: d3fcta1, d3fcta2, d3fctb2, d3fctc1, d3fctc2, d3fctd2
   part of metal chelatase catalytic Fab 7G12; mature antibody
   complexed with ca, cd, mg, mmp, na

Details for d3fctd1

PDB Entry: 3fct, 2.4 Å

PDB Description: mature metal chelatase catalytic antibody with hapten

PDB Compounds: (D:) protein (metal chelatase catalytic antibody)

SCOPe Domain Sequences for d3fctd1:

Sequence; same for both SEQRES and ATOM records:

>d3fctd1 b.1.1.1 (D:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqllesgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigmidpnsggtky
nekfkskatltvdkpsntaymqlssltsedsavyyctrrdmdywgagttvtvss

Timeline for d3fctd1:

• d3fctd1 first appeared (with stable ids) in SCOP 1.55
  
• d3fctd1 appears in SCOPe 2.02
  
• d3fctd1 appears in SCOPe 2.04
  
• d3fctd1 appears in the current release, SCOPe 2.08