SCOPe 2.06: Domain d2cdfa1: 2cdf A:3-115

Lineage for d2cdfa1 (2cdf A:3-115)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d2cdfa1: 2cdf A:3-115 [203762]
   automated match to d1qrnd1

Details for d2cdfa1

PDB Entry: 2cdf, 2.25 Å

PDB Description: structure and binding kinetics of three different human cd1d-alpha-galactosylceramide-specific t cell receptors (tcr 5e)

PDB Compounds: (A:) tcr 5e

SCOPe Domain Sequences for d2cdfa1:

Sequence; same for both SEQRES and ATOM records:

>d2cdfa1 b.1.1.0 (A:3-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nqveqspqflsiqegenltvycnsssvfsslqwyrqepgegpvllvtvvtggevkklkrl
tfqfgdarkdsslhitaaqpgdtglylcagadrgstlgrlyfgrgtqltvwpd

Timeline for d2cdfa1:

• d2cdfa1 first appeared in SCOPe 2.03
  
• d2cdfa1 appears in SCOPe 2.05
  
• d2cdfa1 appears in SCOPe 2.07
  
• d2cdfa1 appears in the current release, SCOPe 2.08