Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [187532] (5 PDB entries) |
Domain d2ccgb_: 2ccg B: [203761] automated match to d4tmka_ complexed with tmp |
PDB Entry: 2ccg (more details), 2.3 Å
SCOPe Domain Sequences for d2ccgb_:
Sequence, based on SEQRES records: (download)
>d2ccgb_ c.37.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]} msafitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdir teamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefai nglypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfks vnadqplenvvedtyqtiikyleki
>d2ccgb_ c.37.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]} msafitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdir teamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefai nglypdltiylnvsaevgreriiknsldqedlkfhekviegyqeiihnesqrfksvnadq plenvvedtyqtiikyleki
Timeline for d2ccgb_: