Lineage for d3fctc1 (3fct C:1-107)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653521Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)
  8. 653624Domain d3fctc1: 3fct C:1-107 [20376]
    Other proteins in same PDB: d3fcta2, d3fctb1, d3fctb2, d3fctc2, d3fctd1, d3fctd2
    part of metal chelatase catalytic Fab 7G12; mature antibody
    complexed with ca, cd, mg, mmp, na

Details for d3fctc1

PDB Entry: 3fct (more details), 2.4 Å

PDB Description: mature metal chelatase catalytic antibody with hapten
PDB Compounds: (C:) protein (metal chelatase catalytic antibody)

SCOP Domain Sequences for d3fctc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fctc1 b.1.1.1 (C:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
elvmtqtpkfmsttvgdrvsitckasqnvgtpvawyqqkpgqspklliysasnrytgvpd
rftgsgsgtdftltisnmqsedladyfcqqyssypltfgggtkveik

SCOP Domain Coordinates for d3fctc1:

Click to download the PDB-style file with coordinates for d3fctc1.
(The format of our PDB-style files is described here.)

Timeline for d3fctc1: