Lineage for d2c9ha2 (2c9h A:282-444)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1881081Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1881082Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1881785Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1881786Protein automated matches [196909] (52 species)
    not a true protein
  7. 1882034Species Human (Homo sapiens) [TaxId:9606] [224964] (6 PDB entries)
  8. 1882042Domain d2c9ha2: 2c9h A:282-444 [203756]
    automated match to d2alma2
    complexed with ni

Details for d2c9ha2

PDB Entry: 2c9h (more details), 1.8 Å

PDB Description: structure of mitochondrial beta-ketoacyl synthase
PDB Compounds: (A:) mitochondrial beta-ketoacyl synthase

SCOPe Domain Sequences for d2c9ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c9ha2 c.95.1.0 (A:282-444) automated matches {Human (Homo sapiens) [TaxId: 9606]}
riyaevlgyglsgdaghitapdpegegalrcmaaalkdagvqpeeisyinahatstplgd
aaenkaikhlfkdhayalavsstkgatghllgaagaveaafttlacyyqklpptlnldcs
epefdlnyvplkaqewktekrfigltnsfgfggtnatlciagl

SCOPe Domain Coordinates for d2c9ha2:

Click to download the PDB-style file with coordinates for d2c9ha2.
(The format of our PDB-style files is described here.)

Timeline for d2c9ha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c9ha1