SCOP 1.59: Domain d3fcta1: 3fct A:1-107

Lineage for d3fcta1 (3fct A:1-107)

Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (6 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
Species Mature metal chelatase catalytic Fab, (human), kappa L chain [48879] (1 PDB entry)
Domain d3fcta1: 3fct A:1-107 [20374]
Other proteins in same PDB: d3fcta2, d3fctb2, d3fctc2, d3fctd2

Details for d3fcta1

PDB Entry: 3fct (more details), 2.4 Å

PDB Description: mature metal chelatase catalytic antibody with hapten

SCOP Domain Sequences for d3fcta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fcta1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Mature metal chelatase catalytic Fab, (human), kappa L chain}
elvmtqtpkfmsttvgdrvsitckasqnvgtpvawyqqkpgqspklliysasnrytgvpd
rftgsgsgtdftltisnmqsedladyfcqqyssypltfgggtkveik

SCOP Domain Coordinates for d3fcta1:

Click to download the PDB-style file with coordinates for d3fcta1.
(The format of our PDB-style files is described here.)

Timeline for d3fcta1: