Lineage for d2pcpd1 (2pcp D:1-113)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 450916Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451214Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (143 PDB entries)
  8. 451300Domain d2pcpd1: 2pcp D:1-113 [20373]
    Other proteins in same PDB: d2pcpa1, d2pcpa2, d2pcpb2, d2pcpc1, d2pcpc2, d2pcpd2
    part of Fab 6B5

Details for d2pcpd1

PDB Entry: 2pcp (more details), 2.2 Å

PDB Description: antibody fab complexed with phencyclidine

SCOP Domain Sequences for d2pcpd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pcpd1 b.1.1.1 (D:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
evqlqqsgpelvkpgasvkmsckasgytftdyyihwnkqshgkslewigyiypnnggngy
nhkfkgkatltvdkssstaymdvrtltsedsavyycgrstwddfdywgqgttltvss

SCOP Domain Coordinates for d2pcpd1:

Click to download the PDB-style file with coordinates for d2pcpd1.
(The format of our PDB-style files is described here.)

Timeline for d2pcpd1: