Lineage for d2pcpd1 (2pcp D:1-113)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 157954Species Fab 6B5, (mouse), kappa L chain [48878] (1 PDB entry)
  8. 157958Domain d2pcpd1: 2pcp D:1-113 [20373]
    Other proteins in same PDB: d2pcpa2, d2pcpb2, d2pcpc2, d2pcpd2

Details for d2pcpd1

PDB Entry: 2pcp (more details), 2.2 Å

PDB Description: antibody fab complexed with phencyclidine

SCOP Domain Sequences for d2pcpd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pcpd1 b.1.1.1 (D:1-113) Immunoglobulin (variable domains of L and H chains) {Fab 6B5, (mouse), kappa L chain}
evqlqqsgpelvkpgasvkmsckasgytftdyyihwnkqshgkslewigyiypnnggngy
nhkfkgkatltvdkssstaymdvrtltsedsavyycgrstwddfdywgqgttltvss

SCOP Domain Coordinates for d2pcpd1:

Click to download the PDB-style file with coordinates for d2pcpd1.
(The format of our PDB-style files is described here.)

Timeline for d2pcpd1: