SCOP 1.57: Domain d2pcpd1: 2pcp D:1-113

Lineage for d2pcpd1 (2pcp D:1-113)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Fab 6B5, (mouse), kappa L chain [48878] (1 PDB entry)

8. Domain d2pcpd1: 2pcp D:1-113 [20373]
   Other proteins in same PDB: d2pcpa2, d2pcpb2, d2pcpc2, d2pcpd2

Details for d2pcpd1

PDB Entry: 2pcp, 2.2 Å

PDB Description: antibody fab complexed with phencyclidine

SCOP Domain Sequences for d2pcpd1:

Sequence; same for both SEQRES and ATOM records:

>d2pcpd1 b.1.1.1 (D:1-113) Immunoglobulin (variable domains of L and H chains) {Fab 6B5, (mouse), kappa L chain}
evqlqqsgpelvkpgasvkmsckasgytftdyyihwnkqshgkslewigyiypnnggngy
nhkfkgkatltvdkssstaymdvrtltsedsavyycgrstwddfdywgqgttltvss

Timeline for d2pcpd1:

• d2pcpd1 first appeared (with stable ids) in SCOP 1.55
  
• d2pcpd1 appears in SCOP 1.59
  
• d2pcpd1 appears in the current release, SCOPe 2.08