Lineage for d2pcpc1 (2pcp C:1-107)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653172Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (127 PDB entries)
  8. 653262Domain d2pcpc1: 2pcp C:1-107 [20372]
    Other proteins in same PDB: d2pcpa2, d2pcpb1, d2pcpb2, d2pcpc2, d2pcpd1, d2pcpd2
    part of Fab 6B5
    complexed with 1pc

Details for d2pcpc1

PDB Entry: 2pcp (more details), 2.2 Å

PDB Description: antibody fab complexed with phencyclidine
PDB Compounds: (C:) immunoglobulin

SCOP Domain Sequences for d2pcpc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pcpc1 b.1.1.1 (C:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
dvlmtqtplslpvslgdqasiscrssqtivhsngntylewylqkpgqspklliykvtnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgthapytfgggtkleik

SCOP Domain Coordinates for d2pcpc1:

Click to download the PDB-style file with coordinates for d2pcpc1.
(The format of our PDB-style files is described here.)

Timeline for d2pcpc1: