Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) |
Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
Protein automated matches [226864] (21 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [225030] (2 PDB entries) |
Domain d2c2xb1: 2c2x B:2-121 [203711] Other proteins in same PDB: d2c2xa2, d2c2xb2 automated match to d1a4ia2 |
PDB Entry: 2c2x (more details), 2 Å
SCOPe Domain Sequences for d2c2xb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c2xb1 c.58.1.0 (B:2-121) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} gaimldgkatrdeifgdlkqrvaaldaagrtpglgtilvgddpgsqayvrgkhadcakvg itsirrdlpadistatlnetidelnanpdctgyivqlplpkhldenaalervdpakdadg
Timeline for d2c2xb1: