SCOPe 2.06: Domain d2c20e_: 2c20 E:

Lineage for d2c20e_ (2c20 E:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:198094] [189998] (4 PDB entries)

8. Domain d2c20e_: 2c20 E: [203707]
   automated match to d3enkb_
   complexed with nad, zn

Details for d2c20e_

PDB Entry: 2c20, 2.7 Å

PDB Description: crystal structure of udp-glucose 4-epimerase

PDB Compounds: (E:) UDP-glucose 4-epimerase

SCOPe Domain Sequences for d2c20e_:

Sequence; same for both SEQRES and ATOM records:

>d2c20e_ c.2.1.0 (E:) automated matches {Bacillus anthracis [TaxId: 198094]}
nsilicggagyigshavkklvdeglsvvvvdnlqtghedaitegakfyngdlrdkaflrd
vftqenieavmhfaadslvgvsmekplqyynnnvygalcllevmdefkvdkfifsstaat
ygevdvdliteetmtnptntygetklaiekmlhwysqasnlrykifryfnvagatpngii
gedhrpethliplvlqvalgqrekimmfgddyntpdgtcirdyihvedlvaahflglkdl
qnggesdfynlgngngfsvkeivdavrevtnheipaevaprragdparlvassqkakekl
gwdpryvnvktiiehawnwhqkqpngyek

Timeline for d2c20e_:

• d2c20e_ first appeared in SCOPe 2.03
  
• d2c20e_ appears in SCOPe 2.05
  
• d2c20e_ appears in SCOPe 2.07
  
• d2c20e_ appears in the current release, SCOPe 2.08