Lineage for d2c20e_ (2c20 E:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1580213Species Bacillus anthracis [TaxId:198094] [189998] (3 PDB entries)
  8. 1580232Domain d2c20e_: 2c20 E: [203707]
    automated match to d3enkb_
    complexed with nad, zn

Details for d2c20e_

PDB Entry: 2c20 (more details), 2.7 Å

PDB Description: crystal structure of udp-glucose 4-epimerase
PDB Compounds: (E:) UDP-glucose 4-epimerase

SCOPe Domain Sequences for d2c20e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c20e_ c.2.1.0 (E:) automated matches {Bacillus anthracis [TaxId: 198094]}
nsilicggagyigshavkklvdeglsvvvvdnlqtghedaitegakfyngdlrdkaflrd
vftqenieavmhfaadslvgvsmekplqyynnnvygalcllevmdefkvdkfifsstaat
ygevdvdliteetmtnptntygetklaiekmlhwysqasnlrykifryfnvagatpngii
gedhrpethliplvlqvalgqrekimmfgddyntpdgtcirdyihvedlvaahflglkdl
qnggesdfynlgngngfsvkeivdavrevtnheipaevaprragdparlvassqkakekl
gwdpryvnvktiiehawnwhqkqpngyek

SCOPe Domain Coordinates for d2c20e_:

Click to download the PDB-style file with coordinates for d2c20e_.
(The format of our PDB-style files is described here.)

Timeline for d2c20e_: