![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
![]() | Species Tumor-specific Fab SM3, (mouse), lambda L chain [48877] (1 PDB entry) |
![]() | Domain d1sm3h1: 1sm3 H:1-113 [20369] Other proteins in same PDB: d1sm3h2, d1sm3l2 |
PDB Entry: 1sm3 (more details), 1.95 Å
SCOP Domain Sequences for d1sm3h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sm3h1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Tumor-specific Fab SM3, (mouse), lambda L chain} qvqlqesggglvqpggsmklscvasgftfsnywmnwvrqspekglewvaeirlksnnyat hyaesvkgrftisrddskssvylqmnnlraedtgiyyctgvgqfaywgqgttvtvss
Timeline for d1sm3h1: