Lineage for d2c1pl1 (2c1p L:2-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760149Domain d2c1pl1: 2c1p L:2-107 [203689]
    Other proteins in same PDB: d2c1pa2, d2c1pb_, d2c1ph_, d2c1pl2
    automated match to d2fatl1
    complexed with fnz

Details for d2c1pl1

PDB Entry: 2c1p (more details), 2 Å

PDB Description: fab-fragment of enantioselective antibody complexed with finrozole
PDB Compounds: (L:) igk-c protein

SCOPe Domain Sequences for d2c1pl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c1pl1 b.1.1.0 (L:2-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lvmtqspltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrliylvsklds
gdpdrftgsgsgtdftlkisrveaedlgiyycvqgshfpptfgagtklelk

SCOPe Domain Coordinates for d2c1pl1:

Click to download the PDB-style file with coordinates for d2c1pl1.
(The format of our PDB-style files is described here.)

Timeline for d2c1pl1: