Lineage for d2c1ol2 (2c1o L:108-212)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1296776Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)
  8. 1297169Domain d2c1ol2: 2c1o L:108-212 [203686]
    automated match to d2fd6l2

Details for d2c1ol2

PDB Entry: 2c1o (more details), 2.75 Å

PDB Description: enaiihis fab fragment in the free form
PDB Compounds: (L:) igk-c protein

SCOPe Domain Sequences for d2c1ol2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c1ol2 b.1.1.0 (L:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d2c1ol2:

Click to download the PDB-style file with coordinates for d2c1ol2.
(The format of our PDB-style files is described here.)

Timeline for d2c1ol2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c1ol1