SCOPe 2.05: Domain d2c1ol1: 2c1o L:1-107

Lineage for d2c1ol1 (2c1o L:1-107)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d2c1ol1: 2c1o L:1-107 [203685]
   automated match to d2fatl1

Details for d2c1ol1

PDB Entry: 2c1o, 2.75 Å

PDB Description: enaiihis fab fragment in the free form

PDB Compounds: (L:) igk-c protein

SCOPe Domain Sequences for d2c1ol1:

Sequence; same for both SEQRES and ATOM records:

>d2c1ol1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elvmtqspltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrliylvskld
sgdpdrftgsgsgtdftlkisrveaedlgiyycvqgshfpptfgagtklelk

Timeline for d2c1ol1:

• d2c1ol1 first appeared in SCOPe 2.03
  
• d2c1ol1 appears in SCOPe 2.04
  
• d2c1ol1 appears in SCOPe 2.06
  
• d2c1ol1 appears in the current release, SCOPe 2.08