Lineage for d1sm3l1 (1sm3 L:3-107)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 653767Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 653854Species Mouse (Mus musculus) [TaxId:10090] [88541] (33 PDB entries)
  8. 653864Domain d1sm3l1: 1sm3 L:3-107 [20368]
    Other proteins in same PDB: d1sm3h1, d1sm3h2, d1sm3l2
    part of tumor-specific Fab SM3 against epithelial mucin Muc1
    complexed with cd, cl

Details for d1sm3l1

PDB Entry: 1sm3 (more details), 1.95 Å

PDB Description: crystal structure of the tumor specific antibody sm3 complex with its peptide epitope
PDB Compounds: (L:) sm3 antibody

SCOP Domain Sequences for d1sm3l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sm3l1 b.1.1.1 (L:3-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
ivvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
arfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlg

SCOP Domain Coordinates for d1sm3l1:

Click to download the PDB-style file with coordinates for d1sm3l1.
(The format of our PDB-style files is described here.)

Timeline for d1sm3l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sm3l2