Lineage for d1sm3l1 (1sm3 L:3-107)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 8073Species Tumor-specific Fab SM3, (mouse), lambda L chain [48877] (1 PDB entry)
  8. 8075Domain d1sm3l1: 1sm3 L:3-107 [20368]
    Other proteins in same PDB: d1sm3h2, d1sm3l2

Details for d1sm3l1

PDB Entry: 1sm3 (more details), 1.95 Å

PDB Description: crystal structure of the tumor specific antibody sm3 complex with its peptide epitope

SCOP Domain Sequences for d1sm3l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sm3l1 b.1.1.1 (L:3-107) Immunoglobulin (variable domains of L and H chains) {Tumor-specific Fab SM3, (mouse), lambda L chain}
ivvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
arfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlg

SCOP Domain Coordinates for d1sm3l1:

Click to download the PDB-style file with coordinates for d1sm3l1.
(The format of our PDB-style files is described here.)

Timeline for d1sm3l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sm3l2