SCOP 1.55: Domain d1sbsh1: 1sbs H:1-123

Lineage for d1sbsh1 (1sbs H:1-123)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Anti-HCG Fab 3A2, (mouse), kappa L chain [48876] (1 PDB entry)

8. Domain d1sbsh1: 1sbs H:1-123 [20367]
   Other proteins in same PDB: d1sbsh2, d1sbsl2

Details for d1sbsh1

PDB Entry: 1sbs, 2 Å

PDB Description: crystal structure of an anti-hcg fab

SCOP Domain Sequences for d1sbsh1:

Sequence; same for both SEQRES and ATOM records:

>d1sbsh1 b.1.1.1 (H:1-123) Immunoglobulin (variable domains of L and H chains) {Anti-HCG Fab 3A2, (mouse), kappa L chain}
evnleesggglvqpggsmklscvasgftfsnywmnwvrqspekglewvadirlksnnyat
lyaesvkgrftisrddskssvylqmnnlraedtgiyyctrgayyrydyamdywgqgtsvt
vss

Timeline for d1sbsh1:

• d1sbsh1 appears in SCOP 1.57
  
• d1sbsh1 appears in the current release, SCOPe 2.08