Lineage for d2c0ia3 (2c0i A:224-505)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2219707Protein Haemopoetic cell kinase Hck [56151] (1 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 2219708Species Human (Homo sapiens) [TaxId:9606] [56152] (24 PDB entries)
  8. 2219719Domain d2c0ia3: 2c0i A:224-505 [203666]
    Other proteins in same PDB: d2c0ia1, d2c0ia2, d2c0ia4, d2c0ib1, d2c0ib2, d2c0ib4
    automated match to d1qcfa3
    complexed with ca, l1g

Details for d2c0ia3

PDB Entry: 2c0i (more details), 2.3 Å

PDB Description: src family kinase hck with bound inhibitor a-420983
PDB Compounds: (A:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d2c0ia3:

Sequence, based on SEQRES records: (download)

>d2c0ia3 d.144.1.7 (A:224-505) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwt
apeainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpe
elynimmrcwknrpeerptfeyiqsvlddfytatesqyeeip

Sequence, based on observed residues (ATOM records): (download)

>d2c0ia3 d.144.1.7 (A:224-505) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarvipikwtapeainfgsftik
sdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmrcwknr
peerptfeyiqsvlddfytatesqyeeip

SCOPe Domain Coordinates for d2c0ia3:

Click to download the PDB-style file with coordinates for d2c0ia3.
(The format of our PDB-style files is described here.)

Timeline for d2c0ia3: