Lineage for d2bx5o_ (2bx5 O:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289963Protein automated matches [190119] (16 species)
    not a true protein
  7. 1290012Species Escherichia coli [TaxId:562] [225179] (4 PDB entries)
  8. 1290032Domain d2bx5o_: 2bx5 O: [203654]
    automated match to d1fgvl_

Details for d2bx5o_

PDB Entry: 2bx5 (more details), 2.7 Å

PDB Description: Is FR1 the antibody's Achillies heel
PDB Compounds: (O:) vd9 vki light-chain

SCOPe Domain Sequences for d2bx5o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bx5o_ b.1.1.1 (O:) automated matches {Escherichia coli [TaxId: 562]}
diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkvei

SCOPe Domain Coordinates for d2bx5o_:

Click to download the PDB-style file with coordinates for d2bx5o_.
(The format of our PDB-style files is described here.)

Timeline for d2bx5o_: