SCOP 1.63: Domain d1qbml1: 1qbm L:1-107

Lineage for d1qbml1 (1qbm L:1-107)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Anti-cytochrome c Fab E8, (mouse), kappa L chain [48875] (3 PDB entries)

8. Domain d1qbml1: 1qbm L:1-107 [20364]
   Other proteins in same PDB: d1qbmh2, d1qbml2

Details for d1qbml1

PDB Entry: 1qbm, 2.37 Å

PDB Description: fab e8b antibody, x-ray structure at 2.37 angstroms resolution

SCOP Domain Sequences for d1qbml1:

Sequence; same for both SEQRES and ATOM records:

>d1qbml1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Anti-cytochrome c Fab E8, (mouse), kappa L chain}
diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
rfsgsgsgtqyslkinslqpedfgsyycqhfwstpwtfgggtkleik

Timeline for d1qbml1:

• d1qbml1 first appeared (with stable ids) in SCOP 1.55
  
• d1qbml1 appears in SCOP 1.61
  
• d1qbml1 appears in SCOP 1.65
  
• d1qbml1 appears in the current release, SCOPe 2.08