Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (25 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [225154] (1 PDB entry) |
Domain d2bpia2: 2bpi A:84-197 [203628] Other proteins in same PDB: d2bpia1, d2bpib1 automated match to d1dt0a2 complexed with fe |
PDB Entry: 2bpi (more details), 2.52 Å
SCOPe Domain Sequences for d2bpia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bpia2 d.44.1.0 (A:84-197) automated matches {Plasmodium falciparum [TaxId: 36329]} cggephgeikekiqedfgsfnnfkeqfsnilcghfgsgwgwlalnnnnklvilqthdagn pikdntgipiltcdiwehayyidyrndrasyvkawwnlvnwnfanenlkkamqk
Timeline for d2bpia2: