Lineage for d2bklb2 (2bkl B:413-679)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1615834Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1615835Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1617684Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1617685Protein automated matches [190543] (56 species)
    not a true protein
  7. 1617955Species Myxococcus xanthus [TaxId:34] [224966] (1 PDB entry)
  8. 1617957Domain d2bklb2: 2bkl B:413-679 [203610]
    Other proteins in same PDB: d2bkla1, d2bklb1
    automated match to d1e5ta2
    complexed with mes, so4, zah

Details for d2bklb2

PDB Entry: 2bkl (more details), 1.5 Å

PDB Description: structural and mechanistic analysis of two prolyl endopeptidases: role of inter-domain dynamics in catalysis and specificity
PDB Compounds: (B:) prolyl endopeptidase

SCOPe Domain Sequences for d2bklb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bklb2 c.69.1.0 (B:413-679) automated matches {Myxococcus xanthus [TaxId: 34]}
eqyqveqvfyaskdgtkvpmfvvhrkdlkrdgnaptllygyggfnvnmeanfrssilpwl
daggvyavanlrgggeygkawhdagrldkkqnvfddfhaaaeylvqqkytqpkrlaiygg
snggllvgaamtqrpelygavvcavplldmvryhlfgsgrtwipeygtaekpedfktlha
yspyhhvrpdvrypallmmaadhddrvdpmharkfvaavqnspgnpatallrieanaghg
gadqvakaiessvdlysflfqvldvqg

SCOPe Domain Coordinates for d2bklb2:

Click to download the PDB-style file with coordinates for d2bklb2.
(The format of our PDB-style files is described here.)

Timeline for d2bklb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bklb1