Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (56 species) not a true protein |
Species Myxococcus xanthus [TaxId:34] [224966] (1 PDB entry) |
Domain d2bklb2: 2bkl B:413-679 [203610] Other proteins in same PDB: d2bkla1, d2bklb1 automated match to d1e5ta2 complexed with mes, so4, zah |
PDB Entry: 2bkl (more details), 1.5 Å
SCOPe Domain Sequences for d2bklb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bklb2 c.69.1.0 (B:413-679) automated matches {Myxococcus xanthus [TaxId: 34]} eqyqveqvfyaskdgtkvpmfvvhrkdlkrdgnaptllygyggfnvnmeanfrssilpwl daggvyavanlrgggeygkawhdagrldkkqnvfddfhaaaeylvqqkytqpkrlaiygg snggllvgaamtqrpelygavvcavplldmvryhlfgsgrtwipeygtaekpedfktlha yspyhhvrpdvrypallmmaadhddrvdpmharkfvaavqnspgnpatallrieanaghg gadqvakaiessvdlysflfqvldvqg
Timeline for d2bklb2: