SCOP 1.61: Domain d1wejh1: 1wej H:1-112

Lineage for d1wejh1 (1wej H:1-112)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Anti-cytochrome c Fab E8, (mouse), kappa L chain [48875] (3 PDB entries)

8. Domain d1wejh1: 1wej H:1-112 [20361]
   Other proteins in same PDB: d1wejf_, d1wejh2, d1wejl2

Details for d1wejh1

PDB Entry: 1wej, 1.8 Å

PDB Description: igg1 fab fragment (of e8 antibody) complexed with horse cytochrome c at 1.8 a resolution

SCOP Domain Sequences for d1wejh1:

Sequence; same for both SEQRES and ATOM records:

>d1wejh1 b.1.1.1 (H:1-112) Immunoglobulin (variable domains of L and H chains) {Anti-cytochrome c Fab E8, (mouse), kappa L chain}
evqlqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpekglewigridpasgntky
dpkfqdkatitadtssntaylqlssltsedtavyycagydygnfdywgqgtt

Timeline for d1wejh1:

• d1wejh1 first appeared (with stable ids) in SCOP 1.55
  
• d1wejh1 appears in SCOP 1.59
  
• d1wejh1 appears in SCOP 1.63
  
• d1wejh1 appears in the current release, SCOPe 2.08