SCOPe 2.03: Domain d2bgjc1: 2bgj C:16-113

Lineage for d2bgjc1 (2bgj C:16-113)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.0: automated matches [227162] (1 protein)
   not a true family

6. Protein automated matches [226870] (15 species)
   not a true protein

7. Species Rhodobacter capsulatus [TaxId:1061] [225019] (7 PDB entries)

8. Domain d2bgjc1: 2bgj C:16-113 [203600]
   Other proteins in same PDB: d2bgja2, d2bgjb2, d2bgjc2, d2bgjd2
   automated match to d1a8pa1
   complexed with fad

Details for d2bgjc1

PDB Entry: 2bgj, 2.1 Å

PDB Description: x-ray structure of the ferredoxin-nadp(h) reductase from rhodobacter capsulatus at 2.1 angstroms

PDB Compounds: (C:) ferredoxin-nadp(h) reductase

SCOPe Domain Sequences for d2bgjc1:

Sequence; same for both SEQRES and ATOM records:

>d2bgjc1 b.43.4.0 (C:16-113) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
pdaqtvtsvrhwtdtlfsfrvtrpqtlrfrsgefvmigllddngkpimraysiaspawde
elefysikvpdgpltsrlqhikvgeqiilrpkpvgtlv

Timeline for d2bgjc1:

• d2bgjc1 is new in SCOPe 2.03-stable
  
• d2bgjc1 appears in SCOPe 2.04
  
• d2bgjc1 appears in the current release, SCOPe 2.08