![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein automated matches [191280] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189896] (32 PDB entries) |
![]() | Domain d2bc4d1: 2bc4 D:3-93 [203584] Other proteins in same PDB: d2bc4a2, d2bc4b2, d2bc4c2, d2bc4c3, d2bc4d2 automated match to d1hdmb2 complexed with cl |
PDB Entry: 2bc4 (more details), 2.27 Å
SCOPe Domain Sequences for d2bc4d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bc4d1 d.19.1.1 (D:3-93) automated matches {Human (Homo sapiens) [TaxId: 9606]} fvahvestcllddagtpkdftycisfnkdlltcwdpeenkmapcefgvlnslanvlsqhl nqkdtlmqrlrnglqncathtqpfwgsltnr
Timeline for d2bc4d1: