SCOP 1.69: Domain d1mnul1: 1mnu L:1-112

Lineage for d1mnul1 (1mnu L:1-112)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (126 PDB entries)

8. Domain d1mnul1: 1mnu L:1-112 [20358]
   Other proteins in same PDB: d1mnuh1, d1mnuh2, d1mnul2
   part of bactericidal Fab MN12H2 against Neisseria meningitidis

Details for d1mnul1

PDB Entry: 1mnu, 2.5 Å

PDB Description: unliganded bactericidal antibody against neisseria meningitidis

SCOP Domain Sequences for d1mnul1:

Sequence; same for both SEQRES and ATOM records:

>d1mnul1 b.1.1.1 (L:1-112) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
divmtqtplslpvslgdkasiscrssqalvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvffcsqsthvprtfgggtkleik

Timeline for d1mnul1:

• d1mnul1 first appeared (with stable ids) in SCOP 1.55
  
• d1mnul1 appears in SCOP 1.67
  
• d1mnul1 appears in SCOP 1.71
  
• d1mnul1 appears in the current release, SCOPe 2.08