SCOPe 2.04: Domain d2bc4a2: 2bc4 A:97-200

Lineage for d2bc4a2 (2bc4 A:97-200)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (9 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
Domain d2bc4a2: 2bc4 A:97-200 [203579]
Other proteins in same PDB: d2bc4a1, d2bc4b1, d2bc4c1, d2bc4d1
automated match to d1hdma1
complexed with cl

Details for d2bc4a2

PDB Entry: 2bc4 (more details), 2.27 Å

PDB Description: crystal structure of hla-dm

PDB Compounds: (A:) HLA class II histocompatibility antigen, DM alpha chain

SCOPe Domain Sequences for d2bc4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bc4a2 b.1.1.2 (A:97-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srgfpiaevftlkplefgkpntlvcfvsnlfppmltvnwqhhsvpvegfgptfvsavdgl
sfqafsylnftpepsdifscivtheidrytaiaywvprnalpsd

SCOPe Domain Coordinates for d2bc4a2:

Click to download the PDB-style file with coordinates for d2bc4a2.
(The format of our PDB-style files is described here.)

Timeline for d2bc4a2: