Lineage for d2bc4a1 (2bc4 A:13-96)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1641761Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1641762Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1641763Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1642652Protein automated matches [191280] (3 species)
    not a true protein
  7. 1642659Species Human (Homo sapiens) [TaxId:9606] [189896] (24 PDB entries)
  8. 1642674Domain d2bc4a1: 2bc4 A:13-96 [203578]
    Other proteins in same PDB: d2bc4a2, d2bc4b2, d2bc4c2, d2bc4d2
    automated match to d1hdma2
    complexed with cl

Details for d2bc4a1

PDB Entry: 2bc4 (more details), 2.27 Å

PDB Description: crystal structure of hla-dm
PDB Compounds: (A:) HLA class II histocompatibility antigen, DM alpha chain

SCOPe Domain Sequences for d2bc4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bc4a1 d.19.1.1 (A:13-96) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqnhtflhtvycqdgspsvglseaydedqlfffdfsqntrvprlpefadwaqeqgdapai
lfdkefcewmiqqigpkldgkipv

SCOPe Domain Coordinates for d2bc4a1:

Click to download the PDB-style file with coordinates for d2bc4a1.
(The format of our PDB-style files is described here.)

Timeline for d2bc4a1: