SCOPe 2.05: Domain d2bbwb1: 2bbw B:4-125,B:162-223

Lineage for d2bbwb1 (2bbw B:4-125,B:162-223)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (102 PDB entries)

8. Domain d2bbwb1: 2bbw B:4-125,B:162-223 [203576]
   Other proteins in same PDB: d2bbwa2, d2bbwb2
   automated match to d2ak3a1
   complexed with gp5

Details for d2bbwb1

PDB Entry: 2bbw, 2.05 Å

PDB Description: Crystal structure of human adenylate kinase 4 (AK4) in complex with diguanosine pentaphosphate

PDB Compounds: (B:) adenylate kinase 4, AK4

SCOPe Domain Sequences for d2bbwb1:

Sequence; same for both SEQRES and ATOM records:

>d2bbwb1 c.37.1.0 (B:4-125,B:162-223) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kllravilgppgsgkgtvcqriaqnfglqhlssghflrenikastevgemakqyieksll
vpdhvitrlmmselenrrgqhwlldgfprtlgqaealdkicevdlvislnipfetlkdrl
srXdkpeavaarlrqykdvakpvielyksrgvlhqfsgtetnkiwpyvytlfsnkitpiq
skeay

Timeline for d2bbwb1:

• d2bbwb1 first appeared in SCOPe 2.03
  
• d2bbwb1 appears in SCOPe 2.04
  
• d2bbwb1 appears in SCOPe 2.06
  
• d2bbwb1 appears in the current release, SCOPe 2.08