Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (4 families) |
Family d.41.2.0: automated matches [227168] (1 protein) not a true family |
Protein automated matches [226878] (11 species) not a true protein |
Species Helicobacter pylori [TaxId:210] [225050] (2 PDB entries) |
Domain d2b7pc1: 2b7p C:1-102 [203571] Other proteins in same PDB: d2b7pa2, d2b7pb2, d2b7pc2 automated match to d1qapa2 complexed with pht, so4 |
PDB Entry: 2b7p (more details), 2.51 Å
SCOPe Domain Sequences for d2b7pc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b7pc1 d.41.2.0 (C:1-102) automated matches {Helicobacter pylori [TaxId: 210]} meirtfleralkedlghgdlfervlekdfkatafvrakqegvfsgekyalellemtgiec vqtikdkerfkpkdalmeirgdfsmllkvertllnllqhssg
Timeline for d2b7pc1:
View in 3D Domains from other chains: (mouse over for more information) d2b7pa1, d2b7pa2, d2b7pb1, d2b7pb2 |