Lineage for d2mpah1 (2mpa H:1-121)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 51855Species Bactericidal Fab MN12H2, (mouse), kappa L chain [48874] (2 PDB entries)
  8. 51856Domain d2mpah1: 2mpa H:1-121 [20357]
    Other proteins in same PDB: d2mpah2, d2mpal2

Details for d2mpah1

PDB Entry: 2mpa (more details), 2.6 Å

PDB Description: bactericidal antibody against neisseria meningitidis

SCOP Domain Sequences for d2mpah1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mpah1 b.1.1.1 (H:1-121) Immunoglobulin (variable domains of L and H chains) {Bactericidal Fab MN12H2, (mouse), kappa L chain}
evnlqqsgtvlarpgasvrmsckasgysftsywlhwikqrpgqglewiggiypgnrdtry
tqrfkdkakltavtsantaymelssltnedsavyycsiiyfdyadfimdywgqgttvtvs
s

SCOP Domain Coordinates for d2mpah1:

Click to download the PDB-style file with coordinates for d2mpah1.
(The format of our PDB-style files is described here.)

Timeline for d2mpah1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mpah2