SCOP 1.67: Domain d2mpal1: 2mpa L:1-112

Lineage for d2mpal1 (2mpa L:1-112)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (121 PDB entries)

8. Domain d2mpal1: 2mpa L:1-112 [20356]
   Other proteins in same PDB: d2mpah1, d2mpah2, d2mpal2
   part of bactericidal Fab MN12H2 against Neisseria meningitidis
   complexed with cd, cyf, thc

Details for d2mpal1

PDB Entry: 2mpa, 2.6 Å

PDB Description: bactericidal antibody against neisseria meningitidis

SCOP Domain Sequences for d2mpal1:

Sequence; same for both SEQRES and ATOM records:

>d2mpal1 b.1.1.1 (L:1-112) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
divmtqtplslpvslgdkasiscrssqalvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvffcsqsthvprtfgggtkleik

Timeline for d2mpal1:

• d2mpal1 first appeared (with stable ids) in SCOP 1.55
  
• d2mpal1 appears in SCOP 1.65
  
• d2mpal1 appears in SCOP 1.69
  
• d2mpal1 appears in the current release, SCOPe 2.08