Lineage for d2mpal1 (2mpa L:1-112)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 157642Species Bactericidal Fab MN12H2, (mouse), kappa L chain [48874] (3 PDB entries)
  8. 157644Domain d2mpal1: 2mpa L:1-112 [20356]
    Other proteins in same PDB: d2mpah2, d2mpal2

Details for d2mpal1

PDB Entry: 2mpa (more details), 2.6 Å

PDB Description: bactericidal antibody against neisseria meningitidis

SCOP Domain Sequences for d2mpal1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mpal1 b.1.1.1 (L:1-112) Immunoglobulin (variable domains of L and H chains) {Bactericidal Fab MN12H2, (mouse), kappa L chain}
divmtqtplslpvslgdkasiscrssqalvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvffcsqsthvprtfgggtkleik

SCOP Domain Coordinates for d2mpal1:

Click to download the PDB-style file with coordinates for d2mpal1.
(The format of our PDB-style files is described here.)

Timeline for d2mpal1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mpal2