Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species Bactericidal Fab MN12H2, (mouse), kappa L chain [48874] (3 PDB entries) |
Domain d2mpal1: 2mpa L:1-112 [20356] Other proteins in same PDB: d2mpah2, d2mpal2 |
PDB Entry: 2mpa (more details), 2.6 Å
SCOP Domain Sequences for d2mpal1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mpal1 b.1.1.1 (L:1-112) Immunoglobulin (variable domains of L and H chains) {Bactericidal Fab MN12H2, (mouse), kappa L chain} divmtqtplslpvslgdkasiscrssqalvhsngntylhwylqkpgqspklliykvsnrf sgvpdrfsgsgsgtdftlkisrveaedlgvffcsqsthvprtfgggtkleik
Timeline for d2mpal1: