Lineage for d2f58h1 (2f58 H:1-113)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652873Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (36 PDB entries)
  8. 652901Domain d2f58h1: 2f58 H:1-113 [20355]
    Other proteins in same PDB: d2f58h2, d2f58l1, d2f58l2
    part of anti-gp120 (HIV-1) Fab 58.2
    complexed with arn

Details for d2f58h1

PDB Entry: 2f58 (more details), 2.8 Å

PDB Description: igg1 fab fragment (58.2) complex with 12-residue cyclic peptide (including residues 315-324 of hiv-1 gp120) (mn isolate)
PDB Compounds: (H:) protein (igg1 fab 58.2 antibody (heavy chaiin))

SCOP Domain Sequences for d2f58h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f58h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]}
dvqlqqsgpdlvkpsqslsltctvtgysitsgyswhwirqfpgnklewmgyihysagtny
npslksrisitrdtsknqfflqlnsvttedtatyycareeampygnqayyyamdcwgqgt
tvtvss

SCOP Domain Coordinates for d2f58h1:

Click to download the PDB-style file with coordinates for d2f58h1.
(The format of our PDB-style files is described here.)

Timeline for d2f58h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f58h2