Lineage for d2f58l1 (2f58 L:1-107)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219047Species Anti-gp120 (HIV-1) Fab 58.2, (mouse), kappa L chain [48873] (3 PDB entries)
  8. 219053Domain d2f58l1: 2f58 L:1-107 [20354]
    Other proteins in same PDB: d2f58h2, d2f58l2

Details for d2f58l1

PDB Entry: 2f58 (more details), 2.8 Å

PDB Description: igg1 fab fragment (58.2) complex with 12-residue cyclic peptide (including residues 315-324 of hiv-1 gp120) (mn isolate)

SCOP Domain Sequences for d2f58l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f58l1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Anti-gp120 (HIV-1) Fab 58.2, (mouse), kappa L chain}
divltqspaslavslgqratisckasqgvdfdgasfmnwyqqkpgqppkllifaastles
giparfsgrgsgtdftlnihpveeedaatyycqqshedpltfgagtklelk

SCOP Domain Coordinates for d2f58l1:

Click to download the PDB-style file with coordinates for d2f58l1.
(The format of our PDB-style files is described here.)

Timeline for d2f58l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f58l2